PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_009557-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 473aa    MW: 52349.2 Da    PI: 9.0655
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_009557-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.7e-33197253360
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  NNU_009557-RA 197 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSF-DGQIAEIVYKGEHNHPK 253
                    9***************************************.***************85 PP

2WRKY103.31.4e-32393450259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dg++WrKYGqK+vkg+++prsYYrCts++C+v+k ver+ +dpk +++tYeg+Hnhe
  NNU_009557-RA 393 GDGFRWRKYGQKVVKGNPYPRSYYRCTSPKCNVRKYVERALDDPKSFITTYEGKHNHE 450
                    5********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-30183254IPR003657WRKY domain
SuperFamilySSF1182902.75E-26193254IPR003657WRKY domain
SMARTSM007743.2E-37195253IPR003657WRKY domain
PfamPF031061.1E-25197252IPR003657WRKY domain
PROSITE profilePS5081124.122197254IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-33377452IPR003657WRKY domain
SuperFamilySSF1182902.09E-28386452IPR003657WRKY domain
PROSITE profilePS5081134.188387452IPR003657WRKY domain
SMARTSM007743.3E-38392451IPR003657WRKY domain
PfamPF031061.6E-25394450IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MSAEMEVKDS ERVVIAKPVA SRPCSSFRSF SELLTSAINA SPSGAYPETV VAAIRPKTVR  60
FKPVANRAPI GMVPPQGEIS GTAVCSSEKV SKPESKSTVV YKPLAKFVSR TTASLLANLG  120
NFYVSHQQTP SEIQAQTQHG EKANHPSENH LTSNPYLKLP SQLEREIVEP SKMVSQNPEE  180
NQRALPATTS GDRPSYDGYN WRKYGQKQVK GSEYPRSYYK CTHPNCPVKK KVERSFDGQI  240
AEIVYKGEHN HPKPQPPKRQ SSGGQGQEFV SDGTGHDTSY HLWSNTHNER TEGSEGRTEN  300
QNEVGLSVHS TCLGKVVTAN NPLSSGVGTP DNSYGLSGDC EEGSRGMDAE DNEPRCKRRR  360
KNDSQANEIG IPGEKVRDPN VGVQSSTDSE ILGDGFRWRK YGQKVVKGNP YPRSYYRCTS  420
PKCNVRKYVE RALDDPKSFI TTYEGKHNHE MPIARNLNPV ASEPDMLPPN RRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-33197452777Probable WRKY transcription factor 4
2lex_A5e-33197452777Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4700155e-61KC470015.1 Jatropha curcas WRKY transcription factor 04 (WRKY04) gene, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260136.10.0PREDICTED: WRKY transcription factor 44-like isoform X1
RefseqXP_010260135.10.0PREDICTED: WRKY transcription factor 44-like isoform X1
TrEMBLF6HQV70.0F6HQV7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0040g03070.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-105WRKY family protein